| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Thymidylate kinase |
|---|
| Ligand | BDBM50498072 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1461346 (CHEMBL3396196) |
|---|
| IC50 | 8000±n/a nM |
|---|
| Citation |  Naik, M; Raichurkar, A; Bandodkar, BS; Varun, BV; Bhat, S; Kalkhambkar, R; Murugan, K; Menon, R; Bhat, J; Paul, B; Iyer, H; Hussein, S; Tucker, JA; Vogtherr, M; Embrey, KJ; McMiken, H; Prasad, S; Gill, A; Ugarkar, BG; Venkatraman, J; Read, J; Panda, M Structure guided lead generation for M. tuberculosis thymidylate kinase (Mtb TMK): discovery of 3-cyanopyridone and 1,6-naphthyridin-2-one as potent inhibitors. J Med Chem58:753-66 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Thymidylate kinase |
|---|
| Name: | Thymidylate kinase |
|---|
| Synonyms: | KTHY_MYCTU | TMPK | Thymidine monophosphate kinase | dTMP kinase | tmk |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 22636.29 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | ChEMBL_208218 |
|---|
| Residue: | 214 |
|---|
| Sequence: | MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLA
SSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWV
QRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYA
ELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS
|
|
|
|---|
| BDBM50498072 |
|---|
| n/a |
|---|
| Name | BDBM50498072 |
|---|
| Synonyms: | CHEMBL3394158 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H11N3O2S |
|---|
| Mol. Mass. | 273.31 |
|---|
| SMILES | COc1cccc(c1)-c1nc(SC)c(C#N)c(=O)[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
