| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50049805 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_145152 (CHEMBL755956) |
|---|
| Ki | 1.9±n/a nM |
|---|
| Citation |  Cappelli, A; Anzini, M; Vomero, S; Menziani, MC; De Benedetti, PG; Sbacchi, M; Clarke, GD; Mennuni, L Synthesis, biological evaluation, and quantitative receptor docking simulations of 2-[(acylamino)ethyl]-1,4-benzodiazepines as novel tifluadom-like ligands with high affinity and selectivity for kappa-opioid receptors. J Med Chem39:860-72 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50049805 |
|---|
| n/a |
|---|
| Name | BDBM50049805 |
|---|
| Synonyms: | CHEMBL169703 | Thiophene-3-carboxylic acid [5-(2-fluoro-phenyl)-1-methyl-2,3-dihydro-1H-benzo[e][1,4]diazepin-2-ylmethyl]-amide | Tifluadom |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H20FN3OS |
|---|
| Mol. Mass. | 393.477 |
|---|
| SMILES | CN1C(CNC(=O)c2ccsc2)CN=C(c2ccccc2F)c2ccccc12 |t:14| |
|---|
| Structure | 
|
|---|
Search and Browse
