| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50500611 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1548303 (CHEMBL3755754) |
|---|
| IC50 | 95±n/a nM |
|---|
| Citation |  Deekonda, S; Cole, J; Sunna, S; Rankin, D; Largent-Milnes, TM; Davis, P; BassiriRad, NM; Lai, J; Vanderah, TW; Porecca, F; Hruby, VJ Enkephalin analogues with N-phenyl-N-(piperidin-2-ylmethyl)propionamide derivatives: Synthesis and biological evaluations. Bioorg Med Chem Lett26:222-7 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50500611 |
|---|
| n/a |
|---|
| Name | BDBM50500611 |
|---|
| Synonyms: | CHEMBL4299482 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C49H60N6O7 |
|---|
| Mol. Mass. | 845.0367 |
|---|
| SMILES | CCC(=O)N(CC1CCCCN1Cc1ccc2[C@@H](CCCc2c1)N[C@H](Cc1ccccc1)C(=O)NCC(=O)N[C@H](C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(O)=O)c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
