Reaction Details |
| Report a problem with these data |
Target | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
---|
Ligand | BDBM50502708 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1808268 (CHEMBL4307627) |
---|
IC50 | 37012±n/a nM |
---|
Citation | Watkins, SM; Ghose, D; Blain, JM; Grote, DL; Luan, CH; Clare, M; Meganathan, R; Horn, JR; Hagen, TJ Antibacterial activity of 2-amino-4-hydroxypyrimidine-5-carboxylates and binding to Burkholderia pseudomallei 2-C-methyl-d-erythritol-2,4-cyclodiphosphate synthase. Bioorg Med Chem Lett29:0 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
---|
Name: | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
Synonyms: | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 4.6.1.12 | ISPF_SALTY | MECDP-synthase | MECPP-synthase | MECPS | ispF |
Type: | PROTEIN |
Mol. Mass.: | 16899.38 |
Organism: | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
Description: | ChEMBL_119647 |
Residue: | 159 |
Sequence: | MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKL
FPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDL
GCHMDEVNVKATTTEKLGFTGRGEGIACEAVALLMKAAK
|
|
|
BDBM50502708 |
---|
n/a |
---|
Name | BDBM50502708 |
Synonyms: | CHEMBL3222163 |
Type | Small organic molecule |
Emp. Form. | C21H16Br2N2O4S2 |
Mol. Mass. | 584.301 |
SMILES | CCOC(=O)C1=C(C)N=c2s\c(=C/c3cc(Br)c(O)c(Br)c3)c(=O)n2C1c1cccs1 |c:5,t:8| |
Structure |
|