| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50052738 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159317 (CHEMBL769370) |
|---|
| IC50 | 0.3±n/a nM |
|---|
| Citation |  Kim, CU; McGee, LR; Krawczyk, SH; Harwood, E; Harada, Y; Swaminathan, S; Bischofberger, N; Chen, MS; Cherrington, JM; Xiong, SF; Griffin, L; Cundy, KC; Lee, A; Yu, B; Gulnik, S; Erickson, JW New series of potent, orally bioavailable, non-peptidic cyclic sulfones as HIV-1 protease inhibitors. J Med Chem39:3431-4 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50052738 |
|---|
| n/a |
|---|
| Name | BDBM50052738 |
|---|
| Synonyms: | (2R,3R,4R,5R,6R,7R)-2,7-Dibenzyl-1,1-dioxo-3,6-bis-(thiazol-5-ylmethoxy)-1lambda*6*-thiepane-4,5-diol | CHEMBL326764 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H30N2O6S3 |
|---|
| Mol. Mass. | 586.743 |
|---|
| SMILES | O[C@@H]1[C@@H](O)[C@@H](OCc2cncs2)[C@@H](Cc2ccccc2)S(=O)(=O)[C@H](Cc2ccccc2)[C@@H]1OCc1cncs1 |
|---|
| Structure | 
|
|---|
Search and Browse
