| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Pirin |
|---|
| Ligand | BDBM99471 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1830006 (CHEMBL4329880) |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Meyers, J; Chessum, NEA; Ali, S; Mok, NY; Wilding, B; Pasqua, AE; Rowlands, M; Tucker, MJ; Evans, LE; Rye, CS; O'Fee, L; Le Bihan, YV; Burke, R; Carter, M; Workman, P; Blagg, J; Brown, N; van Montfort, RLM; Jones, K; Cheeseman, MD Privileged Structures and Polypharmacology within and between Protein Families. ACS Med Chem Lett9:1199-1204 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Pirin |
|---|
| Name: | Pirin |
|---|
| Synonyms: | PIR | PIR_HUMAN | Probable quercetin 2,3-dioxygenase PIR | Probable quercetinase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32115.50 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_811273 |
|---|
| Residue: | 290 |
|---|
| Sequence: | MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRG
FETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNL
RSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGA
KHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVL
IAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN
|
|
|
|---|
| BDBM99471 |
|---|
| n/a |
|---|
| Name | BDBM99471 |
|---|
| Synonyms: | US8497274, 32 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H18F4N4O3S |
|---|
| Mol. Mass. | 554.515 |
|---|
| SMILES | Fc1ccc(Oc2ccc3nc(NC(=O)C4CC4)sc3c2C#N)cc1NC(=O)Cc1cccc(c1)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
