| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 1D |
|---|
| Ligand | BDBM50051562 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1650 (CHEMBL616742) |
|---|
| Ki | 6.7±n/a nM |
|---|
| Citation |  Ennis, MD; Ghazal, NB; Hoffman, RL; Smith, MW; Schlachter, SK; Lawson, CF; Im, WB; Pregenzer, JF; Svensson, KA; Lewis, RA; Hall, ED; Sutter, DM; Harris, LT; McCall, RB Isochroman-6-carboxamides as highly selective 5-HT1D agonists: potential new treatment for migraine without cardiovascular side effects. J Med Chem41:2180-3 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 1D |
|---|
| Name: | 5-hydroxytryptamine receptor 1D |
|---|
| Synonyms: | 5-HT-1D | 5-HT-1D-alpha | 5-HT1D | 5-hydroxytryptamine receptor 1D (5-HT1D) | 5HT1D_HUMAN | HTR1D | HTR1DA | HTRL | Serotonin (5-HT) receptor | Serotonin Receptor 1D |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 41920.63 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Receptor binding assays were performed using human clone stably expressed in CHO cells. |
|---|
| Residue: | 377 |
|---|
| Sequence: | MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
|
|
|
|---|
| BDBM50051562 |
|---|
| n/a |
|---|
| Name | BDBM50051562 |
|---|
| Synonyms: | 1-(2-Isochroman-1-yl-ethyl)-4-(4-methoxy-phenyl)-piperazine | CHEMBL71724 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H28N2O2 |
|---|
| Mol. Mass. | 352.4699 |
|---|
| SMILES | COc1ccc(cc1)N1CCN(CCC2OCCc3ccccc23)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
