Reaction Details |
| Report a problem with these data |
Target | Chymotrypsinogen A |
---|
Ligand | BDBM50066332 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_49753 (CHEMBL662085) |
---|
Ki | 131000±n/a nM |
---|
Citation | Tucker, TJ; Brady, SF; Lumma, WC; Lewis, SD; Gardell, SJ; Naylor-Olsen, AM; Yan, Y; Sisko, JT; Stauffer, KJ; Lucas, BJ; Lynch, JJ; Cook, JJ; Stranieri, MT; Holahan, MA; Lyle, EA; Baskin, EP; Chen, IW; Dancheck, KB; Krueger, JA; Cooper, CM; Vacca, JP Design and synthesis of a series of potent and orally bioavailable noncovalent thrombin inhibitors that utilize nonbasic groups in the P1 position. J Med Chem41:3210-9 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymotrypsinogen A |
---|
Name: | Chymotrypsinogen A |
Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
Type: | Serine protease |
Mol. Mass.: | 25670.88 |
Organism: | Bos taurus (bovine) |
Description: | n/a |
Residue: | 245 |
Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
BDBM50066332 |
---|
n/a |
---|
Name | BDBM50066332 |
Synonyms: | (S)-1-((R)-2-Amino-2-cyclohexyl-acetyl)-pyrrolidine-2-carboxylic acid 2-carbamoylmethoxy-5-chloro-benzylamide | CHEMBL108717 |
Type | Small organic molecule |
Emp. Form. | C22H31ClN4O4 |
Mol. Mass. | 450.959 |
SMILES | N[C@H](C1CCCCC1)C(=O)N1CCC[C@H]1C(=O)NCc1cc(Cl)ccc1OCC(N)=O |
Structure |
|