| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tryptophan 2,3-dioxygenase |
|---|
| Ligand | BDBM50138828 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1845470 (CHEMBL4345897) |
|---|
| EC50 | 250±n/a nM |
|---|
| Citation |  Parr, BT; Pastor, R; Sellers, BD; Pei, Z; Jaipuri, FA; Castanedo, GM; Gazzard, L; Kumar, S; Li, X; Liu, W; Mendonca, R; Pavana, RK; Potturi, H; Shao, C; Velvadapu, V; Waldo, JP; Wu, G; Yuen, PW; Zhang, Z; Zhang, Y; Harris, SF; Oh, AJ; DiPasquale, A; Dement, K; La, H; Goon, L; Gustafson, A; VanderPorten, EC; Mautino, MR; Liu, Y Implementation of the CYP Index for the Design of Selective Tryptophan-2,3-dioxygenase Inhibitors. ACS Med Chem Lett11:541-549 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tryptophan 2,3-dioxygenase |
|---|
| Name: | Tryptophan 2,3-dioxygenase |
|---|
| Synonyms: | T23O_HUMAN | TDO | TDO2 | TO | TRPO | Tryptamin 2,3-dioxygenase | Tryptophan oxygenase | Tryptophan pyrrolase | Tryptophanase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 47874.48 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_825691 |
|---|
| Residue: | 406 |
|---|
| Sequence: | MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSE
TKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV
ILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHY
RDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIR
IQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYRE
EPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYK
VFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD
|
|
|
|---|
| BDBM50138828 |
|---|
| n/a |
|---|
| Name | BDBM50138828 |
|---|
| Synonyms: | CHEMBL3752060 | US10233190, Example 1417 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H22N2O |
|---|
| Mol. Mass. | 282.3801 |
|---|
| SMILES | O[C@@H](C[C@H]1c2ccccc2-c2cncn12)C1CCCCC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
