| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Chymotrypsinogen A |
|---|
| Ligand | BDBM50066998 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_49929 (CHEMBL660312) |
|---|
| IC50 | 4000±n/a nM |
|---|
| Citation |  Macdonald, SJ; Belton, DJ; Buckley, DM; Spooner, JE; Anson, MS; Harrison, LA; Mills, K; Upton, RJ; Dowle, MD; Smith, RA; Molloy, CR; Risley, C Syntheses of trans-5-oxo-hexahydro-pyrrolo[3,2-b]pyrroles and trans-5-oxo-hexahydro-furo[3,2-b]pyrroles (pyrrolidine trans-lactams and trans-lactones): new pharmacophores for elastase inhibition. J Med Chem41:3919-22 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Chymotrypsinogen A |
|---|
| Name: | Chymotrypsinogen A |
|---|
| Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
|---|
| Type: | Serine protease |
|---|
| Mol. Mass.: | 25670.88 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | n/a |
|---|
| Residue: | 245 |
|---|
| Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
|---|
| BDBM50066998 |
|---|
| n/a |
|---|
| Name | BDBM50066998 |
|---|
| Synonyms: | (3R,6aS)-3-Allyl-2-oxo-hexahydro-furo[3,2-b]pyrrole-4-carboxylic acid ethyl ester | CHEMBL127027 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H17NO4 |
|---|
| Mol. Mass. | 239.2677 |
|---|
| SMILES | CCOC(=O)N1CC[C@@H]2OC(=O)[C@H](CC=C)C12 |
|---|
| Structure | 
|
|---|
Search and Browse
