Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50071621 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_159306 |
---|
IC50 | 10±n/a nM |
---|
Citation | Ro, S; Baek, SG; Lee, B; Park, C; Choy, N; Lee, CS; Son, YC; Choi, H; Koh, JS; Yoon, H; Kim, SC; Ok, JH NMR and topochemical studies of peptidomimetic HIV-I protease inhibitors containing a cis-epoxide amide isostere. Bioorg Med Chem Lett8:2423-6 (1999) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50071621 |
---|
n/a |
---|
Name | BDBM50071621 |
Synonyms: | (S)-N*1*-((S)-1-{(2R,3S)-3-[((S)-1-Benzyl-2-methyl-propylcarbamoyl)-methyl]-oxiranyl}-2-phenyl-ethyl)-2-[(quinoline-2-carbonyl)-amino]-succinamide | CHEMBL79128 |
Type | Small organic molecule |
Emp. Form. | C37H41N5O5 |
Mol. Mass. | 635.7519 |
SMILES | CC(C)[C@H](Cc1ccccc1)NC(=O)C[C@@H]1O[C@@H]1[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)c1ccc2ccccc2n1 |
Structure |
|