Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 11
LigandBDBM50071873
Substrate/Competitorn/a
Meas. Tech.ChEBML_124652
IC50 8.1±n/a nM
Citation de Laszlo SEVisco DAgarwal LChang LChin JCroft GForsyth AFletcher DFrantz BHacker CHanlon WHarper CKostura MLi BLuell SMacCoss MMantlo NO'Neill EAOrevillo CPang MParsons JRolando ASahly YSidler KO'Keefe SJ Pyrroles and other heterocycles as inhibitors of p38 kinase. Bioorg Med Chem Lett 8:2689-94 (1999) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 11
Name:Mitogen-activated protein kinase 11
Synonyms:MAP kinase p38 | Mitogen-activated protein kinase p38 beta | PRKM11 | SAPK2 | SAPK2B | Stress-activated protein kinase 2 | p38-2 | p38-beta | p38b
Type:Enzyme Catalytic Domain
Mol. Mass.:41351.73
Organism:Homo sapiens (Human)
Description:gi_20128774
Residue:364
Sequence:
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL
EIEQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50071873
n/a
NameBDBM50071873
Synonyms:4-[2-(4-Fluoro-phenyl)-5-(4-methanesulfinyl-phenyl)-1H-pyrrol-3-yl]-pyridine | CHEMBL88486
TypeSmall organic molecule
Emp. Form.C22H17FN2OS
Mol. Mass.376.447
SMILESCS(=O)c1ccc(cc1)-c1cc(c([nH]1)-c1ccc(F)cc1)-c1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: