| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Potassium-transporting ATPase subunit beta |
|---|
| Ligand | BDBM50073331 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_29657 |
|---|
| IC50 | 663±n/a nM |
|---|
| Citation |  Nadler, G; Morvan, M; Delimoge, I; Belfiore, P; Zocchetti, A; James, I; Zembryki, D; Lee-Rycakzewski, E; Parini, C; Consolandi, E; Gagliardi, S; Farina, C (2Z,4E)-5-(5,6-dichloro-2-indolyl)-2-methoxy-N-(1,2,2,6,6- pentamethylpiperidin-4-yl)-2,4-pentadienamide, a novel, potent and selective inhibitor of the osteoclast V-ATPase. Bioorg Med Chem Lett8:3621-6 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Potassium-transporting ATPase subunit beta |
|---|
| Name: | Potassium-transporting ATPase subunit beta |
|---|
| Synonyms: | ATP4B | ATP4B_PIG | Gastric H(+)/K(+) ATPase subunit beta | Potassium-transporting ATPase | Potassium-transporting ATPase beta chain | Potassium-transporting ATPase subunit beta | Proton pump beta chain | gp60-90 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 33083.09 |
|---|
| Organism: | Sus scrofa (Pig) |
|---|
| Description: | n/a |
|---|
| Residue: | 290 |
|---|
| Sequence: | MAALQEKKSCSQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMSGIFALCIY
VLMRTIDPYTPDYQDQLKSPGVTLRPDVYGEKGLDISYNVSDSTTWAGLAHTLHRFLAGY
SPAAQEGSINCTSEKYFFQESFLAPNHTKFSCKFTADMLQNCSGRPDPTFGFAEGKPCFI
IKMNRIVKFLPGNSTAPRVDCAFLDQPRDGPPLQVEYFPANGTYSLHYFPYYGKKAQPHY
SNPLVAAKLLNVPRNRDVVIVCKILAEHVSFDNPHDPYEGKVEFKLKIQK
|
|
|
|---|
| BDBM50073331 |
|---|
| n/a |
|---|
| Name | BDBM50073331 |
|---|
| Synonyms: | (2Z,4Z)-5-(5,6-Dichloro-1H-indol-2-yl)-2-methoxy-penta-2,4-dienoic acid (1,2,2,6,6-pentamethyl-piperidin-4-yl)-amide | CHEMBL121126 | TCMDC-139106 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H31Cl2N3O2 |
|---|
| Mol. Mass. | 464.428 |
|---|
| SMILES | CO\C(=C/C=C\c1cc2cc(Cl)c(Cl)cc2[nH]1)C(=O)NC1CC(C)(C)N(C)C(C)(C)C1 |
|---|
| Structure | 
|
|---|
Search and Browse
