| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM50076266 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_90574 (CHEMBL702431) |
|---|
| IC50 | >333000±n/a nM |
|---|
| Citation |  Lin, Z; Neamati, N; Zhao, H; Kiryu, Y; Turpin, JA; Aberham, C; Strebel, K; Kohn, K; Witvrouw, M; Pannecouque, C; Debyser, Z; De Clercq, E; Rice, WG; Pommier, Y; Burke, TR Chicoric acid analogues as HIV-1 integrase inhibitors. J Med Chem42:1401-14 (1999) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | Human immunodeficiency virus type 1 integrase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32231.48 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_90865 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM50076266 |
|---|
| n/a |
|---|
| Name | BDBM50076266 |
|---|
| Synonyms: | (E)-3-(3,4-Diacetoxy-phenyl)-acrylic acid 3-[(E)-3-(3,4-diacetoxy-phenyl)-acryloyloxy]-propyl ester | CHEMBL31175 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H28O12 |
|---|
| Mol. Mass. | 568.5254 |
|---|
| SMILES | CC(=O)Oc1ccc(\C=C\C(=O)OCCCOC(=O)\C=C\c2ccc(OC(C)=O)c(OC(C)=O)c2)cc1OC(C)=O |
|---|
| Structure | 
|
|---|
Search and Browse
