| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM50076548 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_210662 |
|---|
| Ki | 310±n/a nM |
|---|
| Citation |  Dominguez, C; Duffy, DE; Han, Q; Alexander, RS; Galemmo, RA; Park, JM; Wong, PC; Amparo, EC; Knabb, RM; Luettgen, J; Wexler, RR Design and synthesis of potent and selective 5,6-fused heterocyclic thrombin inhibitors. Bioorg Med Chem Lett9:925-30 (1999) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | TRP1 | TRY1 | TRY1_HUMAN | TRYP1 | Thrombin & trypsin | Trypsin | Trypsin I | Trypsin-1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26557.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P07477 |
|---|
| Residue: | 247 |
|---|
| Sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
|
|
|
|---|
| BDBM50076548 |
|---|
| n/a |
|---|
| Name | BDBM50076548 |
|---|
| Synonyms: | 1-[2-(4-Benzyl-piperidin-1-yl)-2-oxo-ethyl]-3-(2-hydroxy-ethyl)-1H-indole-5-carboxamidine | CHEMBL175398 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H30N4O2 |
|---|
| Mol. Mass. | 418.5313 |
|---|
| SMILES | NC(=N)c1ccc2n(CC(=O)N3CCC(Cc4ccccc4)CC3)cc(CCO)c2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
