| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein arginine N-methyltransferase 6 |
|---|
| Ligand | BDBM178103 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1896091 (CHEMBL4398126) |
|---|
| IC50 | 4.0±n/a nM |
|---|
| Citation |  Guo, Z; Zhang, Z; Yang, H; Cao, D; Xu, X; Zheng, X; Chen, D; Wang, Q; Li, Y; Li, J; Du, Z; Wang, X; Chen, L; Ding, J; Shen, J; Geng, M; Huang, X; Xiong, B Design and Synthesis of Potent, Selective Inhibitors of Protein Arginine Methyltransferase 4 against Acute Myeloid Leukemia. J Med Chem62:5414-5433 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein arginine N-methyltransferase 6 |
|---|
| Name: | Protein arginine N-methyltransferase 6 |
|---|
| Synonyms: | ANM6_HUMAN | HRMT1L6 | Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6 | Histone-arginine N-methyltransferase PRMT6 | PRMT6 | Protein arginine methyltransferase 6 (PRMT6) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 41928.48 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 375 |
|---|
| Sequence: | MSQPKKRKLESGGGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYECYSDVSVHEEM
IADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQA
REVVRFNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKE
GGLLLPASAELFIAPISDQMLEWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQG
LSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGE
SEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYK
VGDQEEKTKDFAMED
|
|
|
|---|
| BDBM178103 |
|---|
| n/a |
|---|
| Name | BDBM178103 |
|---|
| Synonyms: | MS023 (Compound 3) | N1-((4-(4-isopropoxyphenyl)-1H-pyrrol-3-yl)methyl)-N1-methylethane-1,2-diamine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H25N3O |
|---|
| Mol. Mass. | 287.3999 |
|---|
| SMILES | CC(C)Oc1ccc(cc1)-c1c[nH]cc1CN(C)CCN |
|---|
| Structure | 
|
|---|
Search and Browse
