| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Similar to alpha-tubulin isoform 1 |
|---|
| Ligand | BDBM50215153 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1905955 (CHEMBL4408313) |
|---|
| IC50 | 3000±n/a nM |
|---|
| Citation |  Romagnoli, R; Oliva, P; Salvador, MK; Camacho, ME; Padroni, C; Brancale, A; Ferla, S; Hamel, E; Ronca, R; Grillo, E; Bortolozzi, R; Rruga, F; Mariotto, E; Viola, G Design, synthesis and biological evaluation of novel vicinal diaryl-substituted 1H-Pyrazole analogues of combretastatin A-4 as highly potent tubulin polymerization inhibitors. Eur J Med Chem181:0 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Similar to alpha-tubulin isoform 1 |
|---|
| Name: | Similar to alpha-tubulin isoform 1 |
|---|
| Synonyms: | Similar to alpha-tubulin isoform 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 10383.05 |
|---|
| Organism: | Bos taurus |
|---|
| Description: | ChEMBL_104716 |
|---|
| Residue: | 99 |
|---|
| Sequence: | CVSASPSTLARLVSRSAMPAGSSTAWNTAFSPMARCQVTKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRSSSTLSSSSQAKKMP
|
|
|
|---|
| BDBM50215153 |
|---|
| n/a |
|---|
| Name | BDBM50215153 |
|---|
| Synonyms: | CHEMBL108621 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H21N3O4 |
|---|
| Mol. Mass. | 355.3877 |
|---|
| SMILES | COc1ccc(cc1N)-c1c[nH]nc1-c1cc(OC)c(OC)c(OC)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
