| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-8 |
|---|
| Ligand | BDBM50529641 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1909301 (CHEMBL4411747) |
|---|
| IC50 | 29±n/a nM |
|---|
| Citation |  Johnson, HWB; Lowe, E; Anderl, JL; Fan, A; Muchamuel, T; Bowers, S; Moebius, DC; Kirk, C; McMinn, DL Required Immunoproteasome Subunit Inhibition Profile for Anti-Inflammatory Efficacy and Clinical Candidate KZR-616 ((2 S,3 R)- N-(( S)-3-(Cyclopent-1-en-1-yl)-1-(( R)-2-methyloxiran-2-yl)-1-oxopropan-2-yl)-3-hydroxy-3-(4-methoxyphenyl)-2-(( S)-2-(2-morpholinoacetamido)propanamido)propenamide). J Med Chem61:11127-11143 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-8 |
|---|
| Name: | Proteasome subunit beta type-8 |
|---|
| Synonyms: | 26S proteosome | LMP7 | Low molecular mass protein 7 | Macropain subunit C13 | Multicatalytic endopeptidase complex subunit C13 | PSB8_HUMAN | PSMB5i | PSMB8 | Proteasome component C13 | Proteasome subunit beta type-8 | Proteasome subunit beta-5i | RING10 | Y2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 30357.49 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1446797 |
|---|
| Residue: | 276 |
|---|
| Sequence: | MALLDVCGAPRGQRPESALPVAGSGRRSDPGHYSFSMRSPELALPRGMQPTEFFQSLGGD
GERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGC
AADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKG
PGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDS
YSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
|
|
|
|---|
| BDBM50529641 |
|---|
| n/a |
|---|
| Name | BDBM50529641 |
|---|
| Synonyms: | CHEMBL4464640 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H41N3O6 |
|---|
| Mol. Mass. | 563.6844 |
|---|
| SMILES | COc1ccc(C[C@H](NC(=O)[C@@H](C)NC(=O)C2CCCCC2)C(=O)N[C@@H](Cc2ccccc2)C(=O)[C@@]2(C)CO2)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
