Reaction Details |
| Report a problem with these data |
Target | Proteasome subunit beta type-2 |
---|
Ligand | BDBM50526811 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1909312 (CHEMBL4411758) |
---|
IC50 | 857±n/a nM |
---|
Citation | Johnson, HWB; Lowe, E; Anderl, JL; Fan, A; Muchamuel, T; Bowers, S; Moebius, DC; Kirk, C; McMinn, DL Required Immunoproteasome Subunit Inhibition Profile for Anti-Inflammatory Efficacy and Clinical Candidate KZR-616 ((2 S,3 R)- N-(( S)-3-(Cyclopent-1-en-1-yl)-1-(( R)-2-methyloxiran-2-yl)-1-oxopropan-2-yl)-3-hydroxy-3-(4-methoxyphenyl)-2-(( S)-2-(2-morpholinoacetamido)propanamido)propenamide). J Med Chem61:11127-11143 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-2 |
---|
Name: | Proteasome subunit beta type-2 |
Synonyms: | 3.4.25.1 | Macropain subunit C7-I | Multicatalytic endopeptidase complex subunit C7-I | PSB2_MOUSE | Proteasome component C7-I | Proteasome subunit beta type-2 | Psmb2 |
Type: | PROTEIN |
Mol. Mass.: | 22907.62 |
Organism: | Mus musculus |
Description: | ChEMBL_108026 |
Residue: | 201 |
Sequence: | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RVIDKDGIHNLENIAFPKRDS
|
|
|
BDBM50526811 |
---|
n/a |
---|
Name | BDBM50526811 |
Synonyms: | Kzr-616 |
Type | Small organic molecule |
Emp. Form. | C30H42N4O8 |
Mol. Mass. | 586.6765 |
SMILES | COc1ccc(cc1)[C@@H](O)[C@H](NC(=O)[C@H](C)NC(=O)CN1CCOCC1)C(=O)N[C@@H](CC1=CCCC1)C(=O)[C@@]1(C)CO1 |t:33| |
Structure |
|