| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50090146 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_159446 |
|---|
| IC50 | 1.6±n/a nM |
|---|
| Citation |  Rano, TA; Cheng, Y; Huening, TT; Zhang, F; Schleif, WA; Gabryelski, L; Olsen, DB; Kuo, LC; Lin, JH; Xu, X; Olah, TV; McLoughlin, DA; King, R; Chapman, KT; Tata, JR Combinatorial diversification of indinavir: in vivo mixture dosing of an HIV protease inhibitor library. Bioorg Med Chem Lett10:1527-30 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50090146 |
|---|
| n/a |
|---|
| Name | BDBM50090146 |
|---|
| Synonyms: | (S)-1-[(2S,4R)-2-Hydroxy-4-((1S,2R)-2-hydroxy-indan-1-ylcarbamoyl)-5-phenyl-pentyl]-4-methanesulfonyl-piperazine-2-carboxylic acid tert-butylamide | CHEMBL432101 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H44N4O6S |
|---|
| Mol. Mass. | 600.769 |
|---|
| SMILES | CC(C)(C)NC(=O)[C@@H]1CN(CCN1C[C@@H](O)C[C@@H](Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12)S(C)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
