Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50090147 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_159446 |
---|
IC50 | 1.1±n/a nM |
---|
Citation | Rano, TA; Cheng, Y; Huening, TT; Zhang, F; Schleif, WA; Gabryelski, L; Olsen, DB; Kuo, LC; Lin, JH; Xu, X; Olah, TV; McLoughlin, DA; King, R; Chapman, KT; Tata, JR Combinatorial diversification of indinavir: in vivo mixture dosing of an HIV protease inhibitor library. Bioorg Med Chem Lett10:1527-30 (2000) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50090147 |
---|
n/a |
---|
Name | BDBM50090147 |
Synonyms: | (S)-4-(3,4-Dichloro-benzyl)-1-[(2S,4R)-2-hydroxy-4-((1S,2R)-2-hydroxy-indan-1-ylcarbamoyl)-5-phenyl-pentyl]-piperazine-2-carboxylic acid tert-butylamide | CHEMBL37383 |
Type | Small organic molecule |
Emp. Form. | C37H46Cl2N4O4 |
Mol. Mass. | 681.692 |
SMILES | CC(C)(C)NC(=O)[C@@H]1CN(Cc2ccc(Cl)c(Cl)c2)CCN1C[C@@H](O)C[C@@H](Cc1ccccc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12 |
Structure |
|