| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gastrotropin |
|---|
| Ligand | BDBM8961 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1929090 (CHEMBL4432266) |
|---|
| Kd | 200000±n/a nM |
|---|
| Citation |  Hendrick, AG; Müller, I; Willems, H; Leonard, PM; Irving, S; Davenport, R; Ito, T; Reeves, J; Wright, S; Allen, V; Wilkinson, S; Heffron, H; Bazin, R; Turney, J; Mitchell, PJ Identification and Investigation of Novel Binding Fragments in the Fatty Acid Binding Protein 6 (FABP6). J Med Chem59:8094-102 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gastrotropin |
|---|
| Name: | Gastrotropin |
|---|
| Synonyms: | FABP6 | FABP6_HUMAN | Fatty acid-binding protein 6 | Gastrotropin | I-15P | I-BABP | ILBP | ILLBP |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 14371.59 |
|---|
| Organism: | Homo sapiens |
|---|
| Description: | ChEMBL_118985 |
|---|
| Residue: | 128 |
|---|
| Sequence: | MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTM
TNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTY
ERVSKRLA
|
|
|
|---|
| BDBM8961 |
|---|
| n/a |
|---|
| Name | BDBM8961 |
|---|
| Synonyms: | 1,2,3,4-tetrahydro-9-acridinamine | 1,2,3,4-tetrahydroacridin-9-amine | 9-THA | 9-amino-1,2,3,4-tetrahydroacridine (THA) | CHEMBL1337960 | CHEMBL95 | Cognex | Tacrine | Tracine | US8999994, Tacrine | cid_1935 | tacrine.HCl |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H14N2 |
|---|
| Mol. Mass. | 198.2637 |
|---|
| SMILES | Nc1c2CCCCc2nc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
