| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50091216 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_147317 (CHEMBL755710) |
|---|
| Ki | 10.4±n/a nM |
|---|
| Citation |  Furness, MS; Zhang, X; Coop, A; Jacobson, AE; Rothman, RB; Dersch, CM; Xu, H; Porreca, F; Rice, KC Probes for narcotic receptor-mediated phenomena. 27. Synthesis and pharmacological evaluation of selective delta-opioid receptor agonists from 4-[(alphaR)-alpha-(2S,5R)-4-substituted-2, 5-dimethyl-1-piperazinyl-3-methoxybenzyl]-N,N-diethylbenzamides and their enantiomers. J Med Chem43:3193-6 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40465.04 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50091216 |
|---|
| n/a |
|---|
| Name | BDBM50091216 |
|---|
| Synonyms: | CHEMBL321927 | N,N-Diethyl-4-[(4-hexyl-2,5-dimethyl-piperazin-1-yl)-(3-methoxy-phenyl)-methyl]-benzamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H47N3O2 |
|---|
| Mol. Mass. | 493.7238 |
|---|
| SMILES | CCCCCCN1C[C@H](C)N(C[C@H]1C)C(c1ccc(cc1)C(=O)N(CC)CC)c1cccc(OC)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
