Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNPY2R
LigandBDBM50091652
Substrate/Competitorn/a
Meas. Tech.ChEMBL_154174
IC50 0.14±n/a nM
Citation Balasubramaniam ATao ZZhai WStein MSheriff SChance WTFischer JEEden PETaylor JELiu CDMcFadden DWVoisin TRoze CLaburthe M Structure-activity studies including a Psi(CH(2)-NH) scan of peptide YY (PYY) active site, PYY(22-36), for interaction with rat intestinal PYY receptors: development of analogues with potent in vivo activity in the intestine. J Med Chem 43:3420-7 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
NPY2R
Name:Neuropeptide Y receptor type 2
Synonyms:NPY-Y2 | Neuropeptide Y receptor type 2 | Neuropeptide Y/peptide YY-Y2 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:42514.44
Organism:RAT
Description:NPY-Y2 NPY2R RAT::Q9ERC0
Residue:381
Sequence:
MGPLGAEADENQTVEVKVELYGSGPTTPRGELPPDPEPELIDSTKLVEVQVVLILAYCSI
ILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP
VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKQISFLIIGLAWGVSALLA
SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYT
RIWSKLKNHVSPGAASDHYHQRRHKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSHVLDL
KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSMTFKAK
KNLEVKKNNGLTDSFSEATNV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50091652
n/a
NameBDBM50091652
Synonyms:CHEMBL269503 | PYY | PYY, rat | Peptide YY(PYY)(YPAKPEAPGEDASPEELSRYYASLAHYLNLVTRQRY)
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: