| Reaction Details |
|---|
 | Report a problem with these data |
| Target | X-box-binding protein 1 |
|---|
| Ligand | BDBM50535814 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1931939 (CHEMBL4477591) |
|---|
| EC50 | 174±n/a nM |
|---|
| Citation |  Xie, M; Zhang, HJ; Deng, AJ; Wu, LQ; Zhang, ZH; Li, ZH; Wang, WJ; Qin, HL Synthesis and Structure-Activity Relationships of N-Dihydrocoptisine-8-ylidene Aromatic Amines and N-Dihydrocoptisine-8-ylidene Aliphatic Amides as Antiulcerative Colitis Agents Targeting XBP1. J Nat Prod79:775-83 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| X-box-binding protein 1 |
|---|
| Name: | X-box-binding protein 1 |
|---|
| Synonyms: | Hepatocarcinogenesis-related transcription factor | Htf | X-box-binding protein 1 | X-box-binding protein 1, cytoplasmic form | X-box-binding protein 1, luminal form | XBP1_RAT | Xbp1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 29677.58 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_109918 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MVVVAAAPSAASAAPKVLLLSGQPASGGRALPLMVPGPRAAGSEASGTPQARKRQRLTHL
SPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLQLENQLLREKTHGLV
IENQELRTRLGMNALVTEEVSEAESKGNGVRLVAGSAESAALRLRAPLQQVQAQLSPPQN
IFPWILTLLPLQILSLISFWAFWTSWTLSCFSNVLPQSLLIWRNSQRSTQKDLVPYQPPF
LCQWGPHQPSWKPLMNSFVLTMYTPSL
|
|
|
|---|
| BDBM50535814 |
|---|
| n/a |
|---|
| Name | BDBM50535814 |
|---|
| Synonyms: | CHEMBL4590909 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H17ClN2O4 |
|---|
| Mol. Mass. | 444.866 |
|---|
| SMILES | Clc1ccc(cc1)\N=c1/n2CCc3cc4OCOc4cc3-c2cc2ccc3OCOc3c12 |
|---|
| Structure | 
|
|---|
Search and Browse
