Reaction Details |
| Report a problem with these data |
Target | Tryptase gamma |
---|
Ligand | BDBM50093142 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_210828 |
---|
Kd | 0.070000±n/a nM |
---|
Citation | Rice, KD; Wang, VR; Gangloff, AR; Kuo, EY; Dener, JM; Newcomb, WS; Young, WB; Putnam, D; Cregar, L; Wong, M; Simpson, PJ Dibasic inhibitors of human mast cell tryptase. Part 2: structure-activity relationships and requirements for potent activity. Bioorg Med Chem Lett10:2361-6 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Tryptase gamma |
---|
Name: | Tryptase gamma |
Synonyms: | PRSS31 | Serine protease 31 | TMT | TPSG1 | TRYG1_HUMAN | Transmembrane tryptase | Tryptase | Tryptase gamma | Tryptase gamma heavy chain | Tryptase gamma light chain |
Type: | PROTEIN |
Mol. Mass.: | 33817.52 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_210833 |
Residue: | 321 |
Sequence: | MALGACGLLLLLAVPGVSLRTLQPGCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRRM
HVCGGSLLSPQWVLTAAHCFSGSLNSSDYQVHLGELEITLSPHFSTVRQIILHSSPSGQP
GTSGDIALVELSVPVTLSSRILPVCLPEASDDFCPGIRCWVTGWGYTREGEPLPPPYSLR
EVKVSVVDTETCRRDYPGPGGSILQPDMLCARGPGDACQDDSGGPLVCQVNGAWVQAGTV
SWGEGCGRPNRPGVYTRVPAYVNWIRRHITASGGSESGYPRLPLLAGLFLPGLFLLLVSC
VLLAKCLLHPSADGTPFPAPD
|
|
|
BDBM50093142 |
---|
n/a |
---|
Name | BDBM50093142 |
Synonyms: | 1,5-di{4-[4-amino(imino)methylaminobenzylcarbamoyl]hexahydro-1-pyrazinylcarbonyloxy}cyclooctane | 1N-(3,3-diphenylpropyl)-4-[4-amino(imino)methylphenylcarboxamidomethyl]benzamide | APC-1390 | CHEMBL46809 | Derivative of piperazine-1-carboxylic acid 5-(piperazine-1-carbonyloxy)-cyclooctyl ester |
Type | Small organic molecule |
Emp. Form. | C36H52N12O6 |
Mol. Mass. | 748.8749 |
SMILES | [#7]\[#6](-[#7])=[#7]/c1ccc(-[#6]-[#7]-[#6](=O)-[#7]-2-[#6]-[#6]-[#7](-[#6]-[#6]-2)-[#6](=O)-[#8]-[#6@H]-2-[#6]-[#6]-[#6]-[#6@H](-[#6]-[#6]-[#6]-2)-[#8]-[#6](=O)-[#7]-2-[#6]-[#6]-[#7](-[#6]-[#6]-2)-[#6](=O)-[#7]-[#6]-c2ccc(cc2)\[#7]=[#6](/[#7])-[#7])cc1 |
Structure |
|