| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HTH-type quorum-sensing regulator RhlR |
|---|
| Ligand | BDBM50275147 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1988608 (CHEMBL4622155) |
|---|
| IC50 | 945000±n/a nM |
|---|
| Citation |  Nam, S; Ham, SY; Kwon, H; Kim, HS; Moon, S; Lee, JH; Lim, T; Son, SH; Park, HD; Byun, Y Discovery and Characterization of Pure RhlR Antagonists against J Med Chem63:8388-8407 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HTH-type quorum-sensing regulator RhlR |
|---|
| Name: | HTH-type quorum-sensing regulator RhlR |
|---|
| Synonyms: | Elastase modulator | RHLR_PSEAE | Regulatory protein RhlR | lasM | rhlR | vsmR | vsmR |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27579.79 |
|---|
| Organism: | Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG12228) |
|---|
| Description: | ChEMBL_108034 |
|---|
| Residue: | 241 |
|---|
| Sequence: | MRNDGGFLLWWDGLRSEMQPIHDSQGVFAVLEKEVRRLGFDYYAYGVRHTIPFTRPKTEV
HGTYPKAWLERYQMQNYGAVDPAILNGLRSSEMVVWSDSLFDQSRMLWNEARDWGLCVGA
TLPIRAPNNLLSVLSVARDQQNISSFEREEIRLRLRCMIELLTQKLTDLEHPMLMSNPVC
LSHREREILQWTADGKSSGEIAIILSISESTVNFHHKNIQKKFDAPNKTLAAAYAAALGL
I
|
|
|
|---|
| BDBM50275147 |
|---|
| n/a |
|---|
| Name | BDBM50275147 |
|---|
| Synonyms: | 6-Gingerol | BDBM50317427 | CHEMBL446043 | Gingerol | [6]-gingerol |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H26O4 |
|---|
| Mol. Mass. | 294.3859 |
|---|
| SMILES | CCCCC[C@H](O)CC(=O)CCc1ccc(O)c(OC)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
