Reaction Details |
| Report a problem with these data |
Target | Growth hormone secretagogue receptor type 1 |
---|
Ligand | BDBM50544379 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1992277 (CHEMBL4626012) |
---|
EC50 | 0.235000±n/a nM |
---|
Citation | Cooper, M; Llinas, A; Hansen, P; Caffrey, M; Ray, A; Sjödin, S; Shamovsky, I; Wada, H; Jellesmark Jensen, T; Sivars, U; Hultin, L; Andersson, U; Lundqvist, S; Gedda, K; Jinton, L; Krutrök, N; Lewis, R; Jansson, P; Gardelli, C Identification and Optimization of Pyrrolidine Derivatives as Highly Potent Ghrelin Receptor Full Agonists. J Med Chem63:9705-9730 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Growth hormone secretagogue receptor type 1 |
---|
Name: | Growth hormone secretagogue receptor type 1 |
Synonyms: | GH-releasing peptide receptor | GHRP | GHS-R | GHSR | GHSR_HUMAN | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor | Ghrelin receptor 1a (GHS-R1a) |
Type: | Receptor |
Mol. Mass.: | 41334.57 |
Organism: | Homo sapiens (Human) |
Description: | Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a. |
Residue: | 366 |
Sequence: | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
|
|
|
BDBM50544379 |
---|
n/a |
---|
Name | BDBM50544379 |
Synonyms: | CHEMBL4643530 |
Type | Small organic molecule |
Emp. Form. | C26H27Cl2N5O5S |
Mol. Mass. | 592.494 |
SMILES | Clc1ccc(-c2cc(no2)C(=O)N[C@H]2CN(C[C@@H]2C(=O)N[C@H]2CCCNC2)S(=O)(=O)c2ccccc2)c(Cl)c1 |r| |
Structure |
|