| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Geranylgeranyl transferase type-1 subunit beta |
|---|
| Ligand | BDBM16179 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_72108 (CHEMBL683552) |
|---|
| IC50 | 3400±n/a nM |
|---|
| Citation |  Bell, IM; Gallicchio, SN; Abrams, M; Beshore, DC; Buser, CA; Culberson, JC; Davide, J; Ellis-Hutchings, M; Fernandes, C; Gibbs, JB; Graham, SL; Hartman, GD; Heimbrook, DC; Homnick, CF; Huff, JR; Kassahun, K; Koblan, KS; Kohl, NE; Lobell, RB; Lynch, JJ; Miller, PA; Omer, CA; Rodrigues, AD; Walsh, ES; Williams, TM Design and biological activity of (S)-4-(5-([1-(3-chlorobenzyl)-2-oxopyrrolidin-3-ylamino]methyl)imidazol-1-ylmethyl)benzonitrile, a 3-aminopyrrolidinone farnesyltransferase inhibitor with excellent cell potency. J Med Chem44:2933-49 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Geranylgeranyl transferase type-1 subunit beta |
|---|
| Name: | Geranylgeranyl transferase type-1 subunit beta |
|---|
| Synonyms: | 2.5.1.59 | GGTase-I-beta | Geranylgeranyl transferase type I | Geranylgeranyl transferase type I beta subunit | Geranylgeranyl transferase type I subunit beta | Geranylgeranyl transferase type-1 subunit beta | PGGT1B | PGTB1_HUMAN | Protein farnesyl/geranylgeranyl transferase | Type I protein geranyl-geranyltransferase subunit beta |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 42369.84 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 377 |
|---|
| Sequence: | MAATEDERLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDM
LDSLDVVNKDDIIEWIYSLQVLPTEDRSNLNRCGFRGSSYLGIPFNPSKAPGTAHPYDSG
HIAMTYTGLSCLVILGDDLSRVNKEACLAGLRALQLEDGSFCAVPEGSENDMRFVYCASC
ICYMLNNWSGMDMKKAITYIRRSMSYDNGLAQGAGLESHGGSTFCGIASLCLMGKLEEVF
SEKELNRIKRWCIMRQQNGYHGRPNKPVDTCYSFWVGATLKLLKIFQYTNFEKNRNYILS
TQDRLVGGFAKWPDSHPDALHAYFGICGLSLMEESGICKVHPALNVSTRTSERLLDLHQS
WKTKDSKQCSENVHIST
|
|
|
|---|
| BDBM16179 |
|---|
| n/a |
|---|
| Name | BDBM16179 |
|---|
| Synonyms: | 4-{[5-({[(3S)-1-(3-chlorobenzyl)-2-oxopyrrolidin-3-yl]amino}methyl)-1H-imidazol-1-yl]methyl}benzonitrile | 4-{[5-({[(3S)-1-[(3-chlorophenyl)methyl]-2-oxopyrrolidin-3-yl]amino}methyl)-1H-imidazol-1-yl]methyl}benzonitrile | CHEMBL312137 | MSD-1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H22ClN5O |
|---|
| Mol. Mass. | 419.907 |
|---|
| SMILES | Clc1cccc(CN2CC[C@H](NCc3cncn3Cc3ccc(cc3)C#N)C2=O)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
