| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM4146 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159462 (CHEMBL878769) |
|---|
| IC50 | 2.5±n/a nM |
|---|
| Citation |  Huang, X; Xu, L; Luo, X; Fan, K; Ji, R; Pei, G; Chen, K; Jiang, H Elucidating the inhibiting mode of AHPBA derivatives against HIV-1 protease and building predictive 3D-QSAR models. J Med Chem45:333-43 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM4146 |
|---|
| n/a |
|---|
| Name | BDBM4146 |
|---|
| Synonyms: | (2S,4S)-N-tert-butyl-4-chloro-1-[(2S,3S)-2-hydroxy-3-[(3-hydroxy-2,6-dimethylphenyl)formamido]-4-phenylbutanoyl]pyrrolidine-2-carboxamide | (3-Hydroxy-2,6-dimethylbenzoyl) -{2(S) -hydroxy-3(S)-amino-4-phenylbutanoyl}-4(S)-Cl-Pro-NH-t-Bu | AHPBA deriv. 31 | CHEMBL116723 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H36ClN3O5 |
|---|
| Mol. Mass. | 530.056 |
|---|
| SMILES | Cc1ccc(O)c(C)c1C(=O)N[C@@H](Cc1ccccc1)[C@H](O)C(=O)N1C[C@@H](Cl)C[C@H]1C(=O)NC(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
