Reaction Details |
| Report a problem with these data |
Target | Proteasome subunit beta type-5 |
---|
Ligand | BDBM50550641 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2027959 (CHEMBL4682117) |
---|
IC50 | 97±n/a nM |
---|
Citation | Xie, SC; Gillett, DL; Spillman, NJ; Tsu, C; Luth, MR; Ottilie, S; Duffy, S; Gould, AE; Hales, P; Seager, BA; Charron, CL; Bruzzese, F; Yang, X; Zhao, X; Huang, SC; Hutton, CA; Burrows, JN; Winzeler, EA; Avery, VM; Dick, LR; Tilley, L Target Validation and Identification of Novel Boronate Inhibitors of the Plasmodium falciparum Proteasome. J Med Chem61:10053-10066 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-5 |
---|
Name: | Proteasome subunit beta type-5 |
Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
Type: | Protein |
Mol. Mass.: | 28480.96 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 263 |
Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
BDBM50550641 |
---|
n/a |
---|
Name | BDBM50550641 |
Synonyms: | CHEMBL4781914 |
Type | Small organic molecule |
Emp. Form. | C15H28BN3O5 |
Mol. Mass. | 341.211 |
SMILES | CC(C)C[C@H](NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(C)=O)B(O)O |r| |
Structure |
|