| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-9 |
|---|
| Ligand | BDBM50550642 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2027960 (CHEMBL4682118) |
|---|
| IC50 | 29±n/a nM |
|---|
| Citation |  Xie, SC; Gillett, DL; Spillman, NJ; Tsu, C; Luth, MR; Ottilie, S; Duffy, S; Gould, AE; Hales, P; Seager, BA; Charron, CL; Bruzzese, F; Yang, X; Zhao, X; Huang, SC; Hutton, CA; Burrows, JN; Winzeler, EA; Avery, VM; Dick, LR; Tilley, L Target Validation and Identification of Novel Boronate Inhibitors of the Plasmodium falciparum Proteasome. J Med Chem61:10053-10066 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-9 |
|---|
| Name: | Proteasome subunit beta type-9 |
|---|
| Synonyms: | LMP2 | Low molecular mass protein 2 | Macropain chain 7 | Multicatalytic endopeptidase complex chain 7 | PSB9_HUMAN | PSMB6i | PSMB9 | Proteasome chain 7 | Proteasome subunit beta-1i | RING12 | Really interesting new gene 12 protein |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 23256.49 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_106197 |
|---|
| Residue: | 219 |
|---|
| Sequence: | MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHER
IYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMV
AGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIA
LAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
|
|
|
|---|
| BDBM50550642 |
|---|
| n/a |
|---|
| Name | BDBM50550642 |
|---|
| Synonyms: | CHEMBL4787081 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H45BN4O7S |
|---|
| Mol. Mass. | 616.577 |
|---|
| SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(=O)NCC(C)(C)C)NS(=O)(=O)c1ccc(C)cc1)B(O)O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
