| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-8 |
|---|
| Ligand | BDBM50550643 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2027962 (CHEMBL4682120) |
|---|
| IC50 | 1.3±n/a nM |
|---|
| Citation |  Xie, SC; Gillett, DL; Spillman, NJ; Tsu, C; Luth, MR; Ottilie, S; Duffy, S; Gould, AE; Hales, P; Seager, BA; Charron, CL; Bruzzese, F; Yang, X; Zhao, X; Huang, SC; Hutton, CA; Burrows, JN; Winzeler, EA; Avery, VM; Dick, LR; Tilley, L Target Validation and Identification of Novel Boronate Inhibitors of the Plasmodium falciparum Proteasome. J Med Chem61:10053-10066 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-8 |
|---|
| Name: | Proteasome subunit beta type-8 |
|---|
| Synonyms: | 26S proteosome | LMP7 | Low molecular mass protein 7 | Macropain subunit C13 | Multicatalytic endopeptidase complex subunit C13 | PSB8_HUMAN | PSMB5i | PSMB8 | Proteasome component C13 | Proteasome subunit beta type-8 | Proteasome subunit beta-5i | RING10 | Y2 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 30357.49 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1446797 |
|---|
| Residue: | 276 |
|---|
| Sequence: | MALLDVCGAPRGQRPESALPVAGSGRRSDPGHYSFSMRSPELALPRGMQPTEFFQSLGGD
GERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGC
AADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKG
PGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDS
YSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
|
|
|
|---|
| BDBM50550643 |
|---|
| n/a |
|---|
| Name | BDBM50550643 |
|---|
| Synonyms: | CHEMBL4749207 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H29BN2O5 |
|---|
| Mol. Mass. | 412.287 |
|---|
| SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)Cc1ccc(O)cc1)B(O)O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
