| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma intracellular receptor 2 |
|---|
| Ligand | BDBM50331291 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2031059 (CHEMBL4685217) |
|---|
| Ki | >10.0±n/a nM |
|---|
| Citation |  Temme, L; Bechthold, E; Schreiber, JA; Gawaskar, S; Schepmann, D; Robaa, D; Sippl, W; Seebohm, G; Wünsch, B Negative allosteric modulators of the GluN2B NMDA receptor with phenylethylamine structure embedded in ring-expanded and ring-contracted scaffolds. Eur J Med Chem190:0 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma intracellular receptor 2 |
|---|
| Name: | Sigma intracellular receptor 2 |
|---|
| Synonyms: | MAC30 | Meningioma-associated protein 30 | S2R | SGMR2_HUMAN | Sigma-2 receptor | Sigma2 receptor | TMEM97 | Transmembrane protein 97 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20857.20 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q5BJF2 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQ
EPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLF
EDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
|
|
|
|---|
| BDBM50331291 |
|---|
| n/a |
|---|
| Name | BDBM50331291 |
|---|
| Synonyms: | (+/-)-3-(4-Phenylbutyl)-2,3,4,5-tetrahydro-1H-3-benzazepine-1,7-diol | CHEMBL1289626 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H25NO2 |
|---|
| Mol. Mass. | 311.418 |
|---|
| SMILES | OC1CN(CCCCc2ccccc2)CCc2cc(O)ccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
