Reaction Details |
| Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM50551242 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2031062 (CHEMBL4685220) |
---|
Ki | 2.1±n/a nM |
---|
Citation | Temme, L; Bechthold, E; Schreiber, JA; Gawaskar, S; Schepmann, D; Robaa, D; Sippl, W; Seebohm, G; Wünsch, B Negative allosteric modulators of the GluN2B NMDA receptor with phenylethylamine structure embedded in ring-expanded and ring-contracted scaffolds. Eur J Med Chem190:0 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20953.88 |
Organism: | Rattus norvegicus (Rat) |
Description: | Q5U3Y7 |
Residue: | 176 |
Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
BDBM50551242 |
---|
n/a |
---|
Name | BDBM50551242 |
Synonyms: | CHEMBL4740593 |
Type | Small organic molecule |
Emp. Form. | C22H27N |
Mol. Mass. | 305.4565 |
SMILES | C(C1CCN(CC1)C1CCc2ccccc2C1)c1ccccc1 |
Structure |
|