Reaction Details |
| Report a problem with these data |
Target | Dual specificity mitogen-activated protein kinase kinase 3 |
---|
Ligand | BDBM50115297 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_123985 (CHEMBL732663) |
---|
IC50 | >30000±n/a nM |
---|
Citation | Matsuno, K; Ichimura, M; Nakajima, T; Tahara, K; Fujiwara, S; Kase, H; Ushiki, J; Giese, NA; Pandey, A; Scarborough, RM; Lokker, NA; Yu, JC; Irie, J; Tsukuda, E; Ide, S; Oda, S; Nomoto, Y Potent and selective inhibitors of platelet-derived growth factor receptor phosphorylation. 1. Synthesis, structure-activity relationship, and biological effects of a new class of quinazoline derivatives. J Med Chem45:3057-66 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dual specificity mitogen-activated protein kinase kinase 3 |
---|
Name: | Dual specificity mitogen-activated protein kinase kinase 3 |
Synonyms: | Dual specificity mitogen-activated protein kinase kinase 3 | MAP kinase kinase 3 | MAP2K3 | MAPK/ERK kinase 3 | MAPK/ERK kinase 3 (MEK3) | MAPKK 3 | MEK3 | MKK3 | MP2K3_HUMAN | PRKMK3 | SKK2 |
Type: | Protein |
Mol. Mass.: | 39321.50 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 347 |
Sequence: | MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
|
|
|
BDBM50115297 |
---|
n/a |
---|
Name | BDBM50115297 |
Synonyms: | 4-(6,7-Dimethoxy-quinazolin-4-yl)-piperazine-1-carboxylic acid (4-cyano-phenyl)-amide | CHEMBL106966 |
Type | Small organic molecule |
Emp. Form. | C22H22N6O3 |
Mol. Mass. | 418.4485 |
SMILES | COc1cc2ncnc(N3CCN(CC3)C(=O)Nc3ccc(cc3)C#N)c2cc1OC |
Structure |
|