Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaspase-8
LigandBDBM50116260
Substrate/Competitorn/a
Meas. Tech.ChEBML_46870
Ki 350±n/a nM
Citation Willoughby CABull HGGarcia-Calvo MJiang JChapman KTThornberry NA Discovery of potent, selective human granzyme B inhibitors that inhibit CTL mediated apoptosis. Bioorg Med Chem Lett 12:2197-200 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Caspase-8
Name:Caspase
Synonyms:Apoptotic cysteine protease | Apoptotic protease Mch-5 | CAP4 | CASP-8 | Caspase-8 subunit p10 | Caspase-8 subunit p18 | FADD-homologous ICE/CED-3-like protease | FADD-like ICE | FLICE | ICE-like apoptotic protease 5 | MACH | MORT1-associated CED-3 homolog
Type:Enzyme
Mol. Mass.:55373.89
Organism:Homo sapiens (Human)
Description:Q14790
Residue:479
Sequence:
MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLS
FLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSF
KFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEE
FSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIIN
NHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQ
LMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQAC
QGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTW
YIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50116260
n/a
NameBDBM50116260
Synonyms:(R)-2-({(2S,5S)-5-[(S)-2-(Acetyl-methyl-amino)-3-(S)-methyl-pentanoylamino]-4-oxo-1,2,4,5,6,7-hexahydro-azepino[3,2,1-hi]indole-2-carbonyl}-amino)-3-oxo-propionic acid | CHEMBL304368
TypeSmall organic molecule
Emp. Form.C25H32N4O7
Mol. Mass.500.5442
SMILESCC[C@H](C)[C@H](N(C)C(C)=O)C(=O)N[C@H]1CCc2cccc3C[C@H](N(c23)C1=O)C(=O)N[C@H](C=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: