Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Ligand | BDBM50116630 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_66275 (CHEMBL678145) |
---|
Ki | 8.9±n/a nM |
---|
Citation | Hamilton, GS; Wu, YQ; Limburg, DC; Wilkinson, DE; Vaal, MJ; Li, JH; Thomas, C; Huang, W; Sauer, H; Ross, DT; Soni, R; Chen, Y; Guo, H; Howorth, P; Valentine, H; Liang, S; Spicer, D; Fuller, M; Steiner, JP Synthesis of N-glyoxyl prolyl and pipecolyl amides and thioesters and evaluation of their in vitro and in vivo nerve regenerative effects. J Med Chem45:3549-57 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
Type: | Isomerase |
Mol. Mass.: | 11953.09 |
Organism: | Homo sapiens (Human) |
Description: | P62942 |
Residue: | 108 |
Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
BDBM50116630 |
---|
n/a |
---|
Name | BDBM50116630 |
Synonyms: | 1-(3,3-Dimethyl-2-oxo-pentanoyl)-pyrrolidine-2-carbothioic acid S-[3-(4-methoxy-phenyl)-propyl] ester | CHEMBL119571 |
Type | Small organic molecule |
Emp. Form. | C22H31NO4S |
Mol. Mass. | 405.551 |
SMILES | CCC(C)(C)C(=O)C(=O)N1CCC[C@H]1C(=O)SCCCc1ccc(OC)cc1 |
Structure |
|