Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMycothiol S-conjugate amidase
LigandBDBM50117086
Substrate/Competitorn/a
Meas. Tech.ChEBML_140808
IC50 26000±n/a nM
Citation Nicholas GMEckman LLRay SHughes ROPfefferkorn JABarluenga SNicolaou KCBewley CA Bromotyrosine-derived natural and synthetic products as inhibitors of mycothiol-S-conjugate amidase. Bioorg Med Chem Lett 12:2487-90 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Mycothiol S-conjugate amidase
Name:Mycothiol S-conjugate amidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32719.79
Organism:Mycobacterium tuberculosis
Description:ChEMBL_626858
Residue:288
Sequence:
MSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNPAMDLPDVHGR
IAEIRRDEMTKAAEILGVEHTWLGFVDSGLPKGDLPPPLPDDCFARVPLEVSTEALVRVV
REFRPHVMTTYDENGGYPHPDHIRCHQVSVAAYEAAGDFCRFPDAGEPWTVSKLYYVHGF
LRERMQMLQDEFARHGQRGPFEQWLAYWDPDHDFLTSRVTTRVECSKYFSQRDDALRAHA
TQIDPNAEFFAAPLAWQERLWPTEEFELARSRIPARPPETELFAGIEP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50117086
n/a
NameBDBM50117086
Synonyms:8,10-Dibromo-4-hydroxy-9-methoxy-1,6-dioxa-2-aza-spiro[4.6]undeca-2,7,9-triene-3-carboxylic acid {2-[4-(2-amino-1-hydroxy-ethyl)-2,6-dibromo-phenoxy]-ethyl}-amide | CHEMBL2367685
TypeSmall organic molecule
Emp. Form.C20H21Br4N3O7
Mol. Mass.735.013
SMILESCOC1=C(Br)C[C@@]2(ON=C([C@@H]2O)C(=O)NCCOc2c(Br)cc(cc2Br)C(O)CN)OC=C1Br |c:2,8,33|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: