Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoic acid receptor RXR-alpha
LigandBDBM50122352
Substrate/Competitorn/a
Meas. Tech.ChEBML_196753
Kd 16±n/a nM
Citation Farmer LJZhi LJeong SLamph WWOsburn DLCroston GFlatten KSHeyman RANadzan AM Retinoic acid receptor ligands based on the 6-cyclopropyl-2,4-hexadienoic acid. Bioorg Med Chem Lett 13:261-4 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Retinoic acid receptor RXR-alpha
Name:Nuclear receptor subfamily 4 group A member 2/Retinoic acid receptor RXR-alpha
Synonyms:Nuclear receptor subfamily 2 group B member 1 | Nuclear receptor subfamily 4 group A member 2 | Retinoid X receptor alpha | Retinoid receptor
Type:PROTEIN
Mol. Mass.:50820.38
Organism:Homo sapiens (Human)
Description:ChEMBL_1456363
Residue:462
Sequence:
MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPING
MGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVP
AHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLID
KRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAEL
AVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVIL
LRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDM
QMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLL
RLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50122352
n/a
NameBDBM50122352
Synonyms:(2E,4E)-3-Methyl-6-[1-(3,5,5,8,8-pentamethyl-5,6,7,8-tetrahydro-naphthalen-2-yl)-cyclopropyl]-hexa-2,4-dienoic acid | CHEMBL89058
TypeSmall organic molecule
Emp. Form.C25H34O2
Mol. Mass.366.5363
SMILESC\C(\C=C\CC1(CC1)c1cc2c(cc1C)C(C)(C)CCC2(C)C)=C/C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: