| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50561625 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2075553 (CHEMBL4731087) |
|---|
| Ki | 284±n/a nM |
|---|
| Citation |  Ghosh, AK; Grillo, A; Raghavaiah, J; Kovela, S; Johnson, ME; Kneller, DW; Wang, YF; Hattori, SI; Higashi-Kuwata, N; Weber, IT; Mitsuya, H Design, Synthesis, and X-ray Studies of Potent HIV-1 Protease Inhibitors with P2-Carboxamide Functionalities. ACS Med Chem Lett11:1965-1972 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50561625 |
|---|
| n/a |
|---|
| Name | BDBM50561625 |
|---|
| Synonyms: | CHEMBL4784475 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H44N4O6S2 |
|---|
| Mol. Mass. | 656.856 |
|---|
| SMILES | [H][C@]12OCC[C@@]1([H])[C@]([H])(CO2)[C@@H](C)C(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc2nc(NC3CC3)sc2c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
