| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM810 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_157736 (CHEMBL765174) |
|---|
| Ki | 0.12±n/a nM |
|---|
| Citation |  Tamamura, H; Koh, Y; Ueda, S; Sasaki, Y; Yamasaki, T; Aoki, M; Maeda, K; Watai, Y; Arikuni, H; Otaka, A; Mitsuya, H; Fujii, N Reduction of peptide character of HIV protease inhibitors that exhibit nanomolar potency against multidrug resistant HIV-1 strains. J Med Chem46:1764-8 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM810 |
|---|
| n/a |
|---|
| Name | BDBM810 |
|---|
| Synonyms: | (3S,4aS,8aS)-N-tert-butyl-2-[(2R,3S)-2-hydroxy-3-[(2S)-2-methanesulfonamido-3-(naphthalene-2-sulfinyl)propanamido]-4-phenylbutyl]-decahydroisoquinoline-3-carboxamide | CHEMBL49002 | Saquinavir/Nelfinavir deriv. 14 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H52N4O6S2 |
|---|
| Mol. Mass. | 724.973 |
|---|
| SMILES | [H][C@@]12CCCC[C@]1([H])CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@@H](CS(=O)c1ccc3ccccc3c1)NS(C)(=O)=O)[C@@H](C2)C(=O)NC(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
