| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase |
|---|
| Ligand | BDBM1434 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2081888 (CHEMBL4737679) |
|---|
| EC50 | 8041±n/a nM |
|---|
| Citation |  Sun, Y; Kang, D; Da, F; Zhang, T; Li, P; Zhang, B; De Clercq, E; Pannecouque, C; Zhan, P; Liu, X Identification of novel potent HIV-1 inhibitors by exploiting the tolerant regions of the NNRTIs binding pocket. Eur J Med Chem214:0 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase |
|---|
| Name: | Reverse transcriptase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29598.37 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WKE8 |
|---|
| Residue: | 254 |
|---|
| Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
|---|
| BDBM1434 |
|---|
| n/a |
|---|
| Name | BDBM1434 |
|---|
| Synonyms: | 11-cyclopropyl-5,11-dihydro-4-methyl-6H-dipyrido[3,2-b:2 ,3 -e][1,4]diazepin-6-one | 2-cyclopropyl-7-methyl-2,4,9,15-tetraazatricyclo[9.4.0.0^{3,8}]pentadeca-1(11),3,5,7,12,14-hexaen-10-one | BI-RG-587 | CHEMBL57 | Nevirapine | Nevirapine (NVP) | US11420959, Example NVP | Viramune |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H14N4O |
|---|
| Mol. Mass. | 266.2979 |
|---|
| SMILES | Cc1ccnc2N(C3CC3)c3ncccc3C(=O)Nc12 |
|---|
| Structure | 
|
|---|
Search and Browse
