| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50128538 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_53146 (CHEMBL665866) |
|---|
| IC50 | 3200±n/a nM |
|---|
| Citation |  Wyss, PC; Gerber, P; Hartman, PG; Hubschwerlen, C; Locher, H; Marty, HP; Stahl, M Novel dihydrofolate reductase inhibitors. Structure-based versus diversity-based library design and high-throughput synthesis and screening. J Med Chem46:2304-12 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_STAAW | folA |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 18232.79 |
|---|
| Organism: | Staphylococcus aureus (strain MW2) |
|---|
| Description: | ChEMBL_53146 |
|---|
| Residue: | 159 |
|---|
| Sequence: | MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRN
VVLTSDTSFNVVGVDVIHSIEDIYQLPGHVFIFGGQILFEEMIDKVDDMYITVIEGKFRG
DTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
|
|
|
|---|
| BDBM50128538 |
|---|
| n/a |
|---|
| Name | BDBM50128538 |
|---|
| Synonyms: | 5-[7-Methoxy-4-(3-nitro-phenyl)-3,4-dihydro-1H-isoquinolin-2-ylmethyl]-pyrimidine-2,4-diamine | CHEMBL78104 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H22N6O3 |
|---|
| Mol. Mass. | 406.4378 |
|---|
| SMILES | COc1ccc2C(CN(Cc3cnc(N)nc3N)Cc2c1)c1cccc(c1)[N+]([O-])=O |
|---|
| Structure | 
|
|---|
Search and Browse
