| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50409723 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_152207 (CHEMBL758926) |
|---|
| EC50 | >100000±n/a nM |
|---|
| Citation |  Chong, Y; Gumina, G; Mathew, JS; Schinazi, RF; Chu, CK l-2',3'-Didehydro-2',3'-dideoxy-3'-fluoronucleosides: synthesis, anti-HIV activity, chemical and enzymatic stability, and mechanism of resistance. J Med Chem46:3245-56 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50409723 |
|---|
| n/a |
|---|
| Name | BDBM50409723 |
|---|
| Synonyms: | CHEMBL475089 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H11F2N5O2 |
|---|
| Mol. Mass. | 271.2234 |
|---|
| SMILES | Nc1ncnc2n(cnc12)[C@@H]1CC(F)(F)[C@H](CO)O1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
