Reaction Details |
| Report a problem with these data |
Target | Bcl2-associated agonist of cell death |
---|
Ligand | BDBM50568339 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2105122 (CHEMBL4813625) |
---|
Ki | 1080±n/a nM |
---|
Citation | Niu, Q; Deng, H; Zhang, Z; Xu, Q; Luan, S; Huang, M; Liu, D; Zhao, L Design, synthesis and biological evaluation of dual Bcl-2/Mcl-1 inhibitors bearing 2-(1H-indol-4-yl)benzoic acid scaffold. Bioorg Med Chem Lett47:0 (2021) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl2-associated agonist of cell death |
---|
Name: | Bcl2-associated agonist of cell death |
Synonyms: | BAD | BAD_HUMAN | BBC6 | BCL2L8 | Bcl-2-binding component 6 | Bcl-2-like protein 8 | Bcl-XL/Bcl-2-associated death promoter | Bcl2 antagonist of cell death | Bcl2-L-8 | Bcl2-antagonist of cell death (BAD) |
Type: | PROTEIN |
Mol. Mass.: | 18393.69 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_478760 |
Residue: | 168 |
Sequence: | MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
|
|
|
BDBM50568339 |
---|
n/a |
---|
Name | BDBM50568339 |
Synonyms: | CHEMBL4876147 |
Type | Small organic molecule |
Emp. Form. | C33H22F3NO2 |
Mol. Mass. | 521.5285 |
SMILES | OC(=O)c1ccccc1-c1cccc2n(Cc3cccc4ccccc34)cc(-c3cccc(c3)C(F)(F)F)c12 |
Structure |
|