Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGonadotropin releasing hormone 1 (GnRHR1)
LigandBDBM50122652
Substrate/Competitorn/a
Meas. Tech.ChEBML_71591
Ki 0.400000±n/a nM
Citation Guo ZChen YWu DZhu YFStruthers RSSaunders JXie QChen C Synthesis and structure-activity relationships of thieno[2,3-d]pyrimidine-2,4-dione derivatives as potent GnRH receptor antagonists. Bioorg Med Chem Lett 13:3617-22 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Gonadotropin releasing hormone 1 (GnRHR1)
Name:Gonadotropin-releasing hormone receptor
Synonyms:GnRH receptor | GnRH-R | Gonadotropin-releasing hormone receptor | Gonadotropin-releasing hormone receptor (GnRH)
Type:Enzyme
Mol. Mass.:37749.45
Organism:Homo sapiens (Human)
Description:P30968
Residue:328
Sequence:
MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL
QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM
IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR
VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL
SDPVNHFFFLFAFLNPCFDPLIYGYFSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50122652
n/a
NameBDBM50122652
Synonyms:1-(4-(1-(2,6-difluorobenzyl)-5-((benzyl(methyl)amino)methyl)-2,4-dioxo-3-phenyl-1,2,3,4-tetrahydrothieno[2,3-d]pyrimidin-6-yl)phenyl)-3-ethylurea | 1-{4-[5-[(Benzyl-methyl-amino)-methyl]-1-(2,6-difluoro-benzyl)-2,4-dioxo-3-phenyl-1,2,3,4-tetrahydro-thieno[2,3-d]pyrimidin-6-yl]-phenyl}-3-ethyl-urea | 1-{4-[5-[(Benzyl-methyl-amino)-methyl]-1-(2,6-difluoro-benzyl)-2,4-dioxo-3-phenyl-1,2,3,4-tetrahydro-thieno[2,3-d]pyrimidin-6-yl]-phenyl}-3-ethyl-urea; HCL.1.5H2O | CHEMBL435167
TypeSmall organic molecule
Emp. Form.C37H33F2N5O3S
Mol. Mass.665.751
SMILESCCNC(=O)Nc1ccc(cc1)-c1sc2n(Cc3c(F)cccc3F)c(=O)n(-c3ccccc3)c(=O)c2c1CN(C)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: