| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM50138663 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_212906 (CHEMBL819934) |
|---|
| Ki | 7780±n/a nM |
|---|
| Citation |  Wendt, MD; Rockway, TW; Geyer, A; McClellan, W; Weitzberg, M; Zhao, X; Mantei, R; Nienaber, VL; Stewart, K; Klinghofer, V; Giranda, VL Identification of novel binding interactions in the development of potent, selective 2-naphthamidine inhibitors of urokinase. Synthesis, structural analysis, and SAR of N-phenyl amide 6-substitution. J Med Chem47:303-24 (2004) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | TRP1 | TRY1 | TRY1_HUMAN | TRYP1 | Thrombin & trypsin | Trypsin | Trypsin I | Trypsin-1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26557.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P07477 |
|---|
| Residue: | 247 |
|---|
| Sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
|
|
|
|---|
| BDBM50138663 |
|---|
| n/a |
|---|
| Name | BDBM50138663 |
|---|
| Synonyms: | 2-naphthimidamide | CHEMBL105171 | Naphthalene-2-carboxamidine | US11584714, Compound 53 | uPa_6 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C11H10N2 |
|---|
| Mol. Mass. | 170.2105 |
|---|
| SMILES | NC(=N)c1ccc2ccccc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
