Reaction Details |
| Report a problem with these data |
Target | Kallikrein-1 |
---|
Ligand | BDBM50140370 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_92386 |
---|
IC50 | >10000±n/a nM |
---|
Citation | Jia, ZJ; Wu, Y; Huang, W; Zhang, P; Clizbe, LA; Goldman, EA; Sinha, U; Arfsten, AE; Edwards, ST; Alphonso, M; Hutchaleelaha, A; Scarborough, RM; Zhu, BY 1-(2-Naphthyl)-1H-pyrazole-5-carboxylamides as potent factor Xa inhibitors. Part 2: A survey of P4 motifs. Bioorg Med Chem Lett14:1221-7 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Kallikrein-1 |
---|
Name: | Kallikrein-1 |
Synonyms: | KLK1 | KLK1_HUMAN | Kallikrein 1 | Kallikrein-1 | Kidney/pancreas/salivary gland kallikrein | Tissue kallikrein |
Type: | Enzyme |
Mol. Mass.: | 28874.69 |
Organism: | Homo sapiens (Human) |
Description: | P06870 |
Residue: | 262 |
Sequence: | MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWV
LTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD
LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKIL
PNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNK
PSVAVRVLSYVKWIEDTIAENS
|
|
|
BDBM50140370 |
---|
n/a |
---|
Name | BDBM50140370 |
Synonyms: | 2-(3-Methanesulfonyl-naphthalen-2-yl)-5-methyl-2H-pyrazole-3-carboxylic acid [2-fluoro-4-(3-oxo-morpholin-4-yl)-phenyl]-amide | CHEMBL281175 |
Type | Small organic molecule |
Emp. Form. | C26H23FN4O5S |
Mol. Mass. | 522.548 |
SMILES | Cc1cc(C(=O)Nc2ccc(cc2F)N2CCOCC2=O)n(n1)-c1cc2ccccc2cc1S(C)(=O)=O |
Structure |
|