| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50576902 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2128491 (CHEMBL4837920) |
|---|
| Ki | 41±n/a nM |
|---|
| Citation |  Zhu, M; Zhou, H; Ma, L; Dong, B; Zhou, J; Zhang, G; Wang, M; Wang, J; Cen, S; Wang, Y Design and evaluation of novel piperidine HIV-1 protease inhibitors with potency against DRV-resistant variants. Eur J Med Chem220:0 (2021) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50576902 |
|---|
| n/a |
|---|
| Name | BDBM50576902 |
|---|
| Synonyms: | CHEMBL4868416 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H38N4O4S |
|---|
| Mol. Mass. | 502.669 |
|---|
| SMILES | CC(C)CN(C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H]1CCCNC1)S(=O)(=O)c1ccc(N)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
